Lineage for d1zoqd1 (1zoq D:2065-2111)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650241Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 650242Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 650243Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (2 proteins)
  6. 650247Protein Nuclear receptor coactivator CBP/p300 ibid domain [69127] (1 species)
  7. 650248Species Mouse (Mus musculus) [TaxId:10090] [69128] (4 PDB entries)
  8. 650250Domain d1zoqd1: 1zoq D:2065-2111 [125454]
    automatically matched to d1kbhb_

Details for d1zoqd1

PDB Entry: 1zoq (more details), 2.37 Å

PDB Description: IRF3-CBP complex
PDB Compounds: (D:) creb-binding protein

SCOP Domain Sequences for d1zoqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoqd1 a.153.1.1 (D:2065-2111) Nuclear receptor coactivator CBP/p300 ibid domain {Mouse (Mus musculus) [TaxId: 10090]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan

SCOP Domain Coordinates for d1zoqd1:

Click to download the PDB-style file with coordinates for d1zoqd1.
(The format of our PDB-style files is described here.)

Timeline for d1zoqd1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zoqc1