| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily) 3 helices, non-globular array; forms interlocked heterodimers with its targets |
Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) ![]() not a true superfamily |
| Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (2 proteins) |
| Protein Nuclear receptor coactivator CBP/p300 ibid domain [69127] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [69128] (4 PDB entries) |
| Domain d1zoqd1: 1zoq D:2065-2111 [125454] automatically matched to d1kbhb_ |
PDB Entry: 1zoq (more details), 2.37 Å
SCOP Domain Sequences for d1zoqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zoqd1 a.153.1.1 (D:2065-2111) Nuclear receptor coactivator CBP/p300 ibid domain {Mouse (Mus musculus) [TaxId: 10090]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan
Timeline for d1zoqd1: