Lineage for d1zoqd_ (1zoq D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013569Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 2013570Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 2013571Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 protein domains)
  6. 2013582Protein automated matches [190180] (2 species)
    not a true protein
  7. 2013583Species Human (Homo sapiens) [TaxId:9606] [186918] (2 PDB entries)
  8. 2013585Domain d1zoqd_: 1zoq D: [125454]
    automated match to d1kbhb_

Details for d1zoqd_

PDB Entry: 1zoq (more details), 2.37 Å

PDB Description: IRF3-CBP complex
PDB Compounds: (D:) creb-binding protein

SCOPe Domain Sequences for d1zoqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoqd_ a.153.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan

SCOPe Domain Coordinates for d1zoqd_:

Click to download the PDB-style file with coordinates for d1zoqd_.
(The format of our PDB-style files is described here.)

Timeline for d1zoqd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zoqc_