SCOPe 2.06: Domain d1zoqc_: 1zoq C:

Lineage for d1zoqc_ (1zoq C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
   3 helices, non-globular array; forms interlocked heterodimers with its targets

4. Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family)
   not a true superfamily

5. Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins)

6. Protein automated matches [190180] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186918] (2 PDB entries)

8. Domain d1zoqc_: 1zoq C: [125453]
   automated match to d1kbhb_

Details for d1zoqc_

PDB Entry: 1zoq, 2.37 Å

PDB Description: IRF3-CBP complex

PDB Compounds: (C:) creb-binding protein

SCOPe Domain Sequences for d1zoqc_:

Sequence; same for both SEQRES and ATOM records:

>d1zoqc_ a.153.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrtakyvan

Timeline for d1zoqc_:

• d1zoqc_ first appeared in SCOP 1.73, called d1zoqc1
  
• d1zoqc_ appears in SCOPe 2.05
  
• d1zoqc_ appears in SCOPe 2.07
  
• d1zoqc_ appears in the current release, SCOPe 2.08