Lineage for d1zoka1 (1zok A:221-313)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2379824Protein Presynaptic protein sap97 [141284] (1 species)
    PSD-95 homologue
  7. 2379825Species Norway rat (Rattus norvegicus) [TaxId:10116] [141285] (1 PDB entry)
    Uniprot Q62696 221-313
  8. 2379826Domain d1zoka1: 1zok A:221-313 [125451]

Details for d1zoka1

PDB Entry: 1zok (more details)

PDB Description: PDZ1 Domain Of Synapse Associated Protein 97
PDB Compounds: (A:) Presynaptic protein SAP97

SCOPe Domain Sequences for d1zoka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoka1 b.36.1.1 (A:221-313) Presynaptic protein sap97 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilrvn
eadvrdvthskavealkeagsivrlyvkrrkaf

SCOPe Domain Coordinates for d1zoka1:

Click to download the PDB-style file with coordinates for d1zoka1.
(The format of our PDB-style files is described here.)

Timeline for d1zoka1: