Lineage for d1zoha_ (1zoh A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544570Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2544704Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)
  8. 2544710Domain d1zoha_: 1zoh A: [125450]
    automated match to d1f0qa_
    complexed with cl, edo, k44, na

Details for d1zoha_

PDB Entry: 1zoh (more details), 1.81 Å

PDB Description: Crystal structure of protein kinase CK2 in complex with TBB-derivatives inhibitors
PDB Compounds: (A:) protein kinase ck2, alpha subunit

SCOPe Domain Sequences for d1zoha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoha_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraae

SCOPe Domain Coordinates for d1zoha_:

Click to download the PDB-style file with coordinates for d1zoha_.
(The format of our PDB-style files is described here.)

Timeline for d1zoha_: