SCOPe 2.08: Domain d1zoga_: 1zog A:

Lineage for d1zoga_ (1zog A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)

8. Domain d1zoga_: 1zog A: [125449]
   automated match to d1f0qa_
   complexed with k37

Details for d1zoga_

PDB Entry: 1zog, 2.3 Å

PDB Description: Crystal structure of protein kinase CK2 in complex with TBB-derivatives

PDB Compounds: (A:) protein kinase ck2, alpha subunit

SCOPe Domain Sequences for d1zoga_:

Sequence; same for both SEQRES and ATOM records:

>d1zoga_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraae

Timeline for d1zoga_:

• d1zoga_ first appeared in SCOP 1.73, called d1zoga1
  
• d1zoga_ appears in SCOPe 2.07