Lineage for d1zofj_ (1zof J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879579Species Helicobacter pylori [TaxId:210] [186917] (2 PDB entries)
  8. 2879590Domain d1zofj_: 1zof J: [125448]
    Other proteins in same PDB: d1zofa1
    automated match to d1qmva_

Details for d1zofj_

PDB Entry: 1zof (more details), 2.95 Å

PDB Description: crystal structure of alkyl hydroperoxide-reductase (ahpc) from helicobacter pylori
PDB Compounds: (J:) alkyl hydroperoxide-reductase

SCOPe Domain Sequences for d1zofj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zofj_ c.47.1.0 (J:) automated matches {Helicobacter pylori [TaxId: 210]}
mvvtklapdfkapavlgnnevdehfelsknlgkngvilffwpkdftfvcpteiiafdkrv
kdfhekgfnvigvsidseqvhfawkntpvekggigqvsfpmvaditksisrdydvlfeea
ialrgaflidknmkvrhavindlplgrnademlrmvdallhfeehgevcpagwrk

SCOPe Domain Coordinates for d1zofj_:

Click to download the PDB-style file with coordinates for d1zofj_.
(The format of our PDB-style files is described here.)

Timeline for d1zofj_: