Lineage for d1zofe_ (1zof E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854891Species Helicobacter pylori [TaxId:210] [186917] (1 PDB entry)
  8. 1854895Domain d1zofe_: 1zof E: [125443]
    Other proteins in same PDB: d1zofa1
    automated match to d1qmva_

Details for d1zofe_

PDB Entry: 1zof (more details), 2.95 Å

PDB Description: crystal structure of alkyl hydroperoxide-reductase (ahpc) from helicobacter pylori
PDB Compounds: (E:) alkyl hydroperoxide-reductase

SCOPe Domain Sequences for d1zofe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zofe_ c.47.1.0 (E:) automated matches {Helicobacter pylori [TaxId: 210]}
mvvtklapdfkapavlgnnevdehfelsknlgkngvilffwpkdftfvcpteiiafdkrv
kdfhekgfnvigvsidseqvhfawkntpvekggigqvsfpmvaditksisrdydvlfeea
ialrgaflidknmkvrhavindlplgrnademlrmvdallhfeehgevcp

SCOPe Domain Coordinates for d1zofe_:

Click to download the PDB-style file with coordinates for d1zofe_.
(The format of our PDB-style files is described here.)

Timeline for d1zofe_: