![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Thioredoxin reductase TsaA [142383] (1 species) |
![]() | Species Helicobacter pylori [TaxId:210] [142384] (1 PDB entry) Uniprot P56876 1-170 |
![]() | Domain d1zofa1: 1zof A:1-170 [125439] Other proteins in same PDB: d1zofb_, d1zofc_, d1zofd_, d1zofe_, d1zoff_, d1zofg_, d1zofh_, d1zofi_, d1zofj_ |
PDB Entry: 1zof (more details), 2.95 Å
SCOPe Domain Sequences for d1zofa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} mvvtklapdfkapavlgnnevdehfelsknlgkngvilffwpkdftfvcpteiiafdkrv kdfhekgfnvigvsidseqvhfawkntpvekggigqvsfpmvaditksisrdydvlfeea ialrgaflidknmkvrhavindlplgrnademlrmvdallhfeehgevcp
Timeline for d1zofa1: