Lineage for d1zofa1 (1zof A:1-170)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877806Protein Thioredoxin reductase TsaA [142383] (1 species)
  7. 2877807Species Helicobacter pylori [TaxId:210] [142384] (1 PDB entry)
    Uniprot P56876 1-170
  8. 2877808Domain d1zofa1: 1zof A:1-170 [125439]
    Other proteins in same PDB: d1zofb_, d1zofc_, d1zofd_, d1zofe_, d1zoff_, d1zofg_, d1zofh_, d1zofi_, d1zofj_

Details for d1zofa1

PDB Entry: 1zof (more details), 2.95 Å

PDB Description: crystal structure of alkyl hydroperoxide-reductase (ahpc) from helicobacter pylori
PDB Compounds: (A:) alkyl hydroperoxide-reductase

SCOPe Domain Sequences for d1zofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]}
mvvtklapdfkapavlgnnevdehfelsknlgkngvilffwpkdftfvcpteiiafdkrv
kdfhekgfnvigvsidseqvhfawkntpvekggigqvsfpmvaditksisrdydvlfeea
ialrgaflidknmkvrhavindlplgrnademlrmvdallhfeehgevcp

SCOPe Domain Coordinates for d1zofa1:

Click to download the PDB-style file with coordinates for d1zofa1.
(The format of our PDB-style files is described here.)

Timeline for d1zofa1: