Lineage for d1zoea1 (1zoe A:7-331)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735376Protein Protein kinase CK2, alpha subunit [56142] (2 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 735382Species Maize (Zea mays) [TaxId:4577] [56143] (16 PDB entries)
  8. 735388Domain d1zoea1: 1zoe A:7-331 [125438]
    automatically matched to d1f0qa_
    complexed with cl, dms, k25

Details for d1zoea1

PDB Entry: 1zoe (more details), 1.77 Å

PDB Description: Crystal structure of protein kinase CK2 in complex with TBB-derivatives inhibitors
PDB Compounds: (A:) protein kinase ck2, alpha subunit

SCOP Domain Sequences for d1zoea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zoea1 d.144.1.7 (A:7-331) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraae

SCOP Domain Coordinates for d1zoea1:

Click to download the PDB-style file with coordinates for d1zoea1.
(The format of our PDB-style files is described here.)

Timeline for d1zoea1: