Lineage for d1zo1w1 (1zo1 W:1-71)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800163Protein Translational initiation factor 1, IF1 [50290] (1 species)
  7. 800164Species Escherichia coli [TaxId:562] [50291] (3 PDB entries)
  8. 800167Domain d1zo1w1: 1zo1 W:1-71 [125417]
    automatically matched to d1hr0w_

Details for d1zo1w1

PDB Entry: 1zo1 (more details), 13.8 Å

PDB Description: if2, if1, and trna fitted to cryo-em data of e. coli 70s initiation complex
PDB Compounds: (W:) translation Initiation Factor 1

SCOP Domain Sequences for d1zo1w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zo1w1 b.40.4.5 (W:1-71) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]}
akekdtirtegvvtealpnatfrvkldsgpeilayisgkmrmhyirilpgdrvvveitpy
dptrgrivyrk

SCOP Domain Coordinates for d1zo1w1:

Click to download the PDB-style file with coordinates for d1zo1w1.
(The format of our PDB-style files is described here.)

Timeline for d1zo1w1: