Lineage for d1zo0a1 (1zo0 A:94-219)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968924Family d.108.1.7: Ornithine decarboxylase antizyme-like [143714] (2 proteins)
    Pfam PF02100; may have evolved different function; putative active site maps to the same location in the common fold
  6. 2968925Protein Ornithine decarboxylase antizyme [143715] (1 species)
  7. 2968926Species Norway rat (Rattus norvegicus) [TaxId:10116] [143716] (1 PDB entry)
    Uniprot P54370 93-218
  8. 2968927Domain d1zo0a1: 1zo0 A:94-219 [125416]

Details for d1zo0a1

PDB Entry: 1zo0 (more details)

PDB Description: nmr structure of antizyme isoform 1 from rat
PDB Compounds: (A:) Ornithine decarboxylase antizyme

SCOPe Domain Sequences for d1zo0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zo0a1 d.108.1.7 (A:94-219) Ornithine decarboxylase antizyme {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ilysderlnvteeptsndktrvlsiqctlteakqvtwravwnggglyielpagplpegsk
dsfaallefaeeqlradhvficfpknredraallrtfsflgfeivrpghplvpkrpdacf
mvytle

SCOPe Domain Coordinates for d1zo0a1:

Click to download the PDB-style file with coordinates for d1zo0a1.
(The format of our PDB-style files is described here.)

Timeline for d1zo0a1: