SCOPe 2.08: Domain d1znxa_: 1znx A:

Lineage for d1znxa_ (1znx A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)

8. Domain d1znxa_: 1znx A: [125413]
   automated match to d1s4qa_
   complexed with 5gp

Details for d1znxa_

PDB Entry: 1znx, 2.35 Å

PDB Description: Crystal Structure Of Mycobacterium tuberculosis Guanylate Kinase In Complex With GMP

PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d1znxa_:

Sequence; same for both SEQRES and ATOM records:

>d1znxa_ c.37.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
lv

Timeline for d1znxa_:

• d1znxa_ first appeared in SCOP 1.73, called d1znxa1
  
• d1znxa_ appears in SCOPe 2.07