Lineage for d1znwa_ (1znw A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845581Protein automated matches [190087] (8 species)
    not a true protein
  7. 1845628Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries)
  8. 1845629Domain d1znwa_: 1znw A: [125412]
    automated match to d1s4qa_

Details for d1znwa_

PDB Entry: 1znw (more details), 2.1 Å

PDB Description: Crystal Structure Of Unliganded Form Of Mycobacterium tuberculosis Guanylate Kinase
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d1znwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znwa_ c.37.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
lv

SCOPe Domain Coordinates for d1znwa_:

Click to download the PDB-style file with coordinates for d1znwa_.
(The format of our PDB-style files is described here.)

Timeline for d1znwa_: