| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein automated matches [190087] (8 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [186809] (11 PDB entries) |
| Domain d1znwa_: 1znw A: [125412] automated match to d1s4qa_ |
PDB Entry: 1znw (more details), 2.1 Å
SCOPe Domain Sequences for d1znwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znwa_ c.37.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vgrvvvlsgpsavgkstvvrclreripnlhfsvsattraprpgevdgvdyhfidptrfqq
lidqgellewaeihgglhrsgtlaqpvraaaatgvpvlievdlagaraikktmpeavtvf
lappswqdlqarligrgtetadviqrrldtarielaaqgdfdkvvvnrrlesacaelvsl
lv
Timeline for d1znwa_: