Class a: All alpha proteins [46456] (258 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) |
Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins) |
Protein ImmE7 protein (Im7) [47347] (1 species) |
Species Escherichia coli [TaxId:562] [47348] (10 PDB entries) |
Domain d1znvc1: 1znv C:1-87 [125411] automatically matched to d1mz8a_ complexed with ni, po4; mutant |
PDB Entry: 1znv (more details), 2 Å
SCOP Domain Sequences for d1znvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znvc1 a.28.2.1 (C:1-87) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]} melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn rddspegivkeikewraangkpgfkqg
Timeline for d1znvc1: