SCOP 1.73: Domain d1znvc1: 1znv C:1-87

Lineage for d1znvc1 (1znv C:1-87)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)

5. Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d1znvc1: 1znv C:1-87 [125411]
   automatically matched to d1mz8a_
   complexed with ni, po4; mutant

Details for d1znvc1

PDB Entry: 1znv, 2 Å

PDB Description: how a his-metal finger endonuclease cole7 binds and cleaves dna with a transition metal ion cofactor

PDB Compounds: (C:) colicin e7 immunity protein

SCOP Domain Sequences for d1znvc1:

Sequence; same for both SEQRES and ATOM records:

>d1znvc1 a.28.2.1 (C:1-87) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

Timeline for d1znvc1:

• d1znvc1 is new in SCOP 1.73
  
• d1znvc1 appears in SCOP 1.75
  
• d1znvc1 appears in the current release, SCOPe 2.08, called d1znvc_