Lineage for d1znvc_ (1znv C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1992161Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 1992162Family a.28.2.1: Colicin E immunity proteins [47346] (4 protein domains)
  6. 1992163Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 1992164Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 1992175Domain d1znvc_: 1znv C: [125411]
    Other proteins in same PDB: d1znvb_, d1znvd_
    automated match to d1mz8a_
    protein/DNA complex; complexed with ni, po4

Details for d1znvc_

PDB Entry: 1znv (more details), 2 Å

PDB Description: How a His-metal finger endonuclease ColE7 binds and cleaves DNA with a transition metal ion cofactor
PDB Compounds: (C:) colicin e7 immunity protein

SCOPe Domain Sequences for d1znvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znvc_ a.28.2.1 (C:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

SCOPe Domain Coordinates for d1znvc_:

Click to download the PDB-style file with coordinates for d1znvc_.
(The format of our PDB-style files is described here.)

Timeline for d1znvc_: