Lineage for d1znva1 (1znv A:1-87)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639785Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 639786Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)
  6. 639787Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 639788Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 639798Domain d1znva1: 1znv A:1-87 [125410]
    automatically matched to d1mz8a_
    complexed with ni, po4; mutant

Details for d1znva1

PDB Entry: 1znv (more details), 2 Å

PDB Description: how a his-metal finger endonuclease cole7 binds and cleaves dna with a transition metal ion cofactor
PDB Compounds: (A:) colicin e7 immunity protein

SCOP Domain Sequences for d1znva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znva1 a.28.2.1 (A:1-87) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

SCOP Domain Coordinates for d1znva1:

Click to download the PDB-style file with coordinates for d1znva1.
(The format of our PDB-style files is described here.)

Timeline for d1znva1: