SCOPe 2.08: Domain d1znva_: 1znv A:

Lineage for d1znva_ (1znv A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE7 protein (Im7) [47347] (1 species)

7. Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)

8. Domain d1znva_: 1znv A: [125410]
   Other proteins in same PDB: d1znvb_, d1znvd_
   automated match to d1mz8a_
   protein/DNA complex; complexed with ni, po4

Details for d1znva_

PDB Entry: 1znv, 2 Å

PDB Description: how a his-metal finger endonuclease cole7 binds and cleaves dna with a transition metal ion cofactor

PDB Compounds: (A:) colicin e7 immunity protein

SCOPe Domain Sequences for d1znva_:

Sequence; same for both SEQRES and ATOM records:

>d1znva_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

Timeline for d1znva_:

• d1znva_ first appeared in SCOP 1.73, called d1znva1
  
• d1znva_ appears in SCOPe 2.07