| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) ![]() automatically mapped to Pfam PF01320 |
| Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
| Protein ImmE7 protein (Im7) [47347] (1 species) |
| Species Escherichia coli [TaxId:562] [47348] (10 PDB entries) |
| Domain d1znva_: 1znv A: [125410] Other proteins in same PDB: d1znvb_, d1znvd_ automated match to d1mz8a_ protein/DNA complex; complexed with ni, po4 |
PDB Entry: 1znv (more details), 2 Å
SCOPe Domain Sequences for d1znva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znva_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg
Timeline for d1znva_: