Lineage for d1znqq2 (1znq Q:152-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2961611Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2961702Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species)
  7. 2961791Species Human (Homo sapiens), liver isoform [TaxId:9606] [143535] (2 PDB entries)
    Uniprot P04406 151-314
  8. 2961798Domain d1znqq2: 1znq Q:152-315 [125406]
    Other proteins in same PDB: d1znqo1, d1znqp1, d1znqq1, d1znqr1
    automated match to d1znqo2
    complexed with nad

Details for d1znqq2

PDB Entry: 1znq (more details), 2.5 Å

PDB Description: crystal structure of human liver gapdh
PDB Compounds: (Q:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOPe Domain Sequences for d1znqq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znqq2 d.81.1.1 (Q:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]}
cttnclaplakvihdnfgiveglmttvhaitatqktvdgpsgklwrdgrgalqniipast
gaakavgkvipelngkltgmafrvptanvsvvdltcrlekpakyddikkvvkqasegplk
gilgytehqvvssdfnsdthsstfdagagialndhfvkliswyd

SCOPe Domain Coordinates for d1znqq2:

Click to download the PDB-style file with coordinates for d1znqq2.
(The format of our PDB-style files is described here.)

Timeline for d1znqq2: