SCOPe 2.06: Domain d1znqq1: 1znq Q:3-151,Q:316-335

Lineage for d1znqq1 (1znq Q:3-151,Q:316-335)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)

7. Species Human (Homo sapiens), liver isoform [TaxId:9606] [141915] (2 PDB entries)
   Uniprot P04406 2-150,315-334

8. Domain d1znqq1: 1znq Q:3-151,Q:316-335 [125405]
   Other proteins in same PDB: d1znqo2, d1znqp2, d1znqq2, d1znqr2
   automated match to d1znqo1
   complexed with nad

Details for d1znqq1

PDB Entry: 1znq, 2.5 Å

PDB Description: crystal structure of human liver gapdh

PDB Compounds: (Q:) Glyceraldehyde-3-phosphate dehydrogenase, liver

SCOPe Domain Sequences for d1znqq1:

Sequence; same for both SEQRES and ATOM records:

>d1znqq1 c.2.1.3 (Q:3-151,Q:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens), liver isoform [TaxId: 9606]}
kvkvgvngfgrigrlvtraafnsgkvdivaindpfidlnymvymfqydsthgkfhgtvka
engklvingnpitifqerdpskikwgdagaeyvvestgvfttmekagahlqggakrviis
apsadapmfvmgvnhekydnslkiisnasXnefgysnrvvdlmahmaske

Timeline for d1znqq1:

• d1znqq1 first appeared in SCOP 1.73
  
• d1znqq1 appears in SCOPe 2.05
  
• d1znqq1 appears in SCOPe 2.07
  
• d1znqq1 appears in the current release, SCOPe 2.08