![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.16: YML079-like [117318] (4 proteins) Pfam PF06172; DUF985 |
![]() | Protein Hypothetical protein Atu3615 [141605] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [141606] (1 PDB entry) Uniprot Q8U9W0 4-143 |
![]() | Domain d1znpf_: 1znp F: [125399] automated match to d1znpa1 |
PDB Entry: 1znp (more details), 2.5 Å
SCOPe Domain Sequences for d1znpf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znpf_ b.82.1.16 (F:) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv spgfafssfvmaepgwspgd
Timeline for d1znpf_: