Lineage for d1znpf_ (1znp F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814960Family b.82.1.16: YML079-like [117318] (4 proteins)
    Pfam PF06172; DUF985
  6. 2814961Protein Hypothetical protein Atu3615 [141605] (1 species)
  7. 2814962Species Agrobacterium tumefaciens [TaxId:358] [141606] (1 PDB entry)
    Uniprot Q8U9W0 4-143
  8. 2814968Domain d1znpf_: 1znp F: [125399]
    automated match to d1znpa1

Details for d1znpf_

PDB Entry: 1znp (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Q8U9W0 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR55.
PDB Compounds: (F:) hypothetical protein Atu3615

SCOPe Domain Sequences for d1znpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znpf_ b.82.1.16 (F:) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]}
msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
spgfafssfvmaepgwspgd

SCOPe Domain Coordinates for d1znpf_:

Click to download the PDB-style file with coordinates for d1znpf_.
(The format of our PDB-style files is described here.)

Timeline for d1znpf_: