SCOPe 2.05: Domain d1znpb_: 1znp B:

Lineage for d1znpb_ (1znp B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.16: YML079-like [117318] (4 proteins)
   Pfam PF06172; DUF985

6. Protein Hypothetical protein Atu3615 [141605] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [141606] (1 PDB entry)
   Uniprot Q8U9W0 4-143

8. Domain d1znpb_: 1znp B: [125395]
   automated match to d1znpa1

Details for d1znpb_

PDB Entry: 1znp, 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Q8U9W0 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR55.

PDB Compounds: (B:) hypothetical protein Atu3615

SCOPe Domain Sequences for d1znpb_:

Sequence; same for both SEQRES and ATOM records:

>d1znpb_ b.82.1.16 (B:) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]}
msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
spgfafssfvmaepgwspgd

Timeline for d1znpb_:

• d1znpb_ first appeared in SCOP 1.73, called d1znpb1
  
• d1znpb_ appears in SCOPe 2.04
  
• d1znpb_ appears in SCOPe 2.06
  
• d1znpb_ appears in the current release, SCOPe 2.08