Lineage for d1znpb_ (1znp B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.16: YML079-like [117318] (4 proteins)
    Pfam PF06172; DUF985
  6. Protein Hypothetical protein Atu3615 [141605] (1 species)
  7. Species Agrobacterium tumefaciens [TaxId:358] [141606] (1 PDB entry)
    Uniprot Q8U9W0 4-143
  8. Domain d1znpb_: 1znp B: [125395]
    automated match to d1znpa1

Details for d1znpb_

PDB Entry: 1znp (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Q8U9W0 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR55.
PDB Compounds: (B:) hypothetical protein Atu3615

SCOPe Domain Sequences for d1znpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znpb_ b.82.1.16 (B:) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]}
msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
spgfafssfvmaepgwspgd

SCOPe Domain Coordinates for d1znpb_ are not available.

Timeline for d1znpb_:

Domains from other chains:
(mouse over for more information)
d1znpa1, d1znpc_, d1znpd_, d1znpe_, d1znpf_, d1znpg_