SCOP 1.73: Domain d1znoa1: 1zno A:10-181

Lineage for d1znoa1 (1zno A:10-181)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (3 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.3: YjjX-like [110621] (2 proteins)
   Pfam PF01931

6. Protein Hypothetical protein VC0702 [142431] (1 species)

7. Species Vibrio cholerae [TaxId:666] [142432] (2 PDB entries)

8. Domain d1znoa1: 1zno A:10-181 [125392]
   automatically matched to 1ZWY A:9-181
   complexed with mg

Details for d1znoa1

PDB Entry: 1zno, 2 Å

PDB Description: Crystal Structure of VC702 from Vibrio Cholerae, Northeast Structural Genomics Consortium Target: VcP1

PDB Compounds: (A:) Hypothetical UPF0244 protein VC0702

SCOP Domain Sequences for d1znoa1:

Sequence, based on SEQRES records:

>d1znoa1 c.51.4.3 (A:10-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakel
gdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyp

Sequence, based on observed residues (ATOM records):

>d1znoa1 c.51.4.3 (A:10-181) Hypothetical protein VC0702 {Vibrio cholerae [TaxId: 666]}
mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerllgdvmd
evenikqkggaiglltrhhltrstvyhqalilalipfinpehyp

Timeline for d1znoa1:

• d1znoa1 is new in SCOP 1.73
  
• d1znoa1 appears in SCOP 1.75
  
• d1znoa1 appears in the current release, SCOPe 2.08, called d1znoa_