Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) |
Family c.1.2.6: PdxS-like [141755] (1 protein) Pfam PF01680; SOR/SNZ |
Protein Pyridoxal biosynthesis lyase PdxS [141756] (1 species) PLP synthase |
Species Bacillus stearothermophilus [TaxId:1422] [141757] (1 PDB entry) |
Domain d1znne1: 1znn E:18-271 [125390] automatically matched to 1ZNN A:18-271 complexed with mrd, so4 |
PDB Entry: 1znn (more details), 2.2 Å
SCOP Domain Sequences for d1znne1:
Sequence, based on SEQRES records: (download)
>d1znne1 c.1.2.6 (E:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} kggvimdvvnaeqakiaeaagavavmalervpadiraaggvarmadptvieevmnavsip vmakvrighyvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaar riaegasmlrtkgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlr eikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatth yedyeliahlskgl
>d1znne1 c.1.2.6 (E:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} kggvimdvvnaeqakiaeaagavavmaleggvarmadptvieevmnavsipvmakvrigh yvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaarriaegasml rtkgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlreikrlgrlp vvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatthyedyeliah lskgl
Timeline for d1znne1: