Lineage for d1znnc_ (1znn C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079751Family c.1.2.6: PdxS-like [141755] (2 protein domains)
    Pfam PF01680; SOR/SNZ
  6. 2079752Protein Pyridoxal biosynthesis lyase PdxS [141756] (1 species)
    PLP synthase
  7. 2079753Species Bacillus stearothermophilus [TaxId:1422] [141757] (1 PDB entry)
    Uniprot Q5L3Y2 18-271
  8. 2079756Domain d1znnc_: 1znn C: [125388]
    automated match to d1znna1
    complexed with mrd, so4

Details for d1znnc_

PDB Entry: 1znn (more details), 2.2 Å

PDB Description: Structure of the synthase subunit of PLP synthase
PDB Compounds: (C:) plp synthase

SCOPe Domain Sequences for d1znnc_:

Sequence, based on SEQRES records: (download)

>d1znnc_ c.1.2.6 (C:) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]}
kggvimdvvnaeqakiaeaagavavmalervpadiraaggvarmadptvieevmnavsip
vmakvrighyvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaar
riaegasmlrtkgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlr
eikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatth
yedyeliahlskgl

Sequence, based on observed residues (ATOM records): (download)

>d1znnc_ c.1.2.6 (C:) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]}
kggvimdvvnaeqakiaeaagavavmaleggvarmadptvieevmnavsipvmakvrigh
yvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaarriaegasml
rtkgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlreikrlgrlp
vvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatthyedyeliah
lskgl

SCOPe Domain Coordinates for d1znnc_:

Click to download the PDB-style file with coordinates for d1znnc_.
(The format of our PDB-style files is described here.)

Timeline for d1znnc_: