Lineage for d1znnb_ (1znn B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414494Family c.1.2.6: PdxS-like [141755] (2 protein domains)
    Pfam PF01680; SOR/SNZ
  6. 2414495Protein Pyridoxal biosynthesis lyase PdxS [141756] (1 species)
    PLP synthase
  7. 2414496Species Bacillus stearothermophilus [TaxId:1422] [141757] (1 PDB entry)
    Uniprot Q5L3Y2 18-271
  8. 2414498Domain d1znnb_: 1znn B: [125387]
    automated match to d1znna1
    complexed with mrd, so4

Details for d1znnb_

PDB Entry: 1znn (more details), 2.2 Å

PDB Description: Structure of the synthase subunit of PLP synthase
PDB Compounds: (B:) plp synthase

SCOPe Domain Sequences for d1znnb_:

Sequence, based on SEQRES records: (download)

>d1znnb_ c.1.2.6 (B:) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]}
kggvimdvvnaeqakiaeaagavavmalervpadiraaggvarmadptvieevmnavsip
vmakvrighyvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaar
riaegasmlrtkgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlr
eikrlgrlpvvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatth
yedyeliahlskgl

Sequence, based on observed residues (ATOM records): (download)

>d1znnb_ c.1.2.6 (B:) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]}
kggvimdvvnaeqakiaeaagavavmaleggvarmadptvieevmnavsipvmakvrigh
yvearvlealgvdyidesevltpadeefhidkrqftvpfvcgcrdlgeaarriaegasml
rtkgepgtgniveavrhmrkvnaqirkvvnmsedelvaeakqlgapvevlreikrlgrlp
vvnfaaggvttpadaalmmhlgadgvfvgsgifksenpekyaraiveatthyedyeliah
lskgl

SCOPe Domain Coordinates for d1znnb_:

Click to download the PDB-style file with coordinates for d1znnb_.
(The format of our PDB-style files is described here.)

Timeline for d1znnb_: