SCOPe 2.05: Domain d1znha_: 1znh A:

Lineage for d1znha_ (1znh A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries)

8. Domain d1znha_: 1znh A: [125383]
   automated match to d1df3a_
   complexed with cd, oc9

Details for d1znha_

PDB Entry: 1znh, 2.1 Å

PDB Description: Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex

PDB Compounds: (A:) major urinary protein

SCOPe Domain Sequences for d1znha_:

Sequence; same for both SEQRES and ATOM records:

>d1znha_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrc

Timeline for d1znha_:

• d1znha_ first appeared in SCOP 1.73, called d1znha1
  
• d1znha_ appears in SCOPe 2.04
  
• d1znha_ appears in SCOPe 2.06
  
• d1znha_ appears in the current release, SCOPe 2.08