SCOP 1.73: Domain d1znga1: 1zng A:1-157

Lineage for d1znga1 (1zng A:1-157)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50833] (18 PDB entries)

8. Domain d1znga1: 1zng A:1-157 [125382]
   automatically matched to d1df3a_
   complexed with cd, he4

Details for d1znga1

PDB Entry: 1zng, 1.6 Å

PDB Description: Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex

PDB Compounds: (A:) major urinary protein

SCOP Domain Sequences for d1znga1:

Sequence; same for both SEQRES and ATOM records:

>d1znga1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrc

Timeline for d1znga1:

• d1znga1 is new in SCOP 1.73
  
• d1znga1 appears in SCOP 1.75
  
• d1znga1 appears in the current release, SCOPe 2.08, called d1znga_