Lineage for d1znda_ (1znd A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413932Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 2413933Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries)
  8. 2413934Domain d1znda_: 1znd A: [125380]
    automated match to d1df3a_
    complexed with cd, pe9

Details for d1znda_

PDB Entry: 1znd (more details), 1.6 Å

PDB Description: Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex
PDB Compounds: (A:) major urinary protein

SCOPe Domain Sequences for d1znda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znda_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrc

SCOPe Domain Coordinates for d1znda_:

Click to download the PDB-style file with coordinates for d1znda_.
(The format of our PDB-style files is described here.)

Timeline for d1znda_: