SCOPe 2.08: Domain d1zn9b_: 1zn9 B:

Lineage for d1zn9b_ (1zn9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Adenine PRTase [53288] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries)

8. Domain d1zn9b_: 1zn9 B: [125379]
   automated match to d1orea_
   complexed with amp

Details for d1zn9b_

PDB Entry: 1zn9, 2.05 Å

PDB Description: Human Adenine Phosphoribosyltransferase in Apo and AMP Complexed Forms

PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d1zn9b_:

Sequence; same for both SEQRES and ATOM records:

>d1zn9b_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

Timeline for d1zn9b_:

• d1zn9b_ first appeared in SCOP 1.73, called d1zn9b1
  
• d1zn9b_ appears in SCOPe 2.07