Lineage for d1zn8a_ (1zn8 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499122Protein Adenine PRTase [53288] (5 species)
  7. 2499134Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries)
  8. 2499135Domain d1zn8a_: 1zn8 A: [125376]
    automated match to d1orea_
    complexed with amp, cl

Details for d1zn8a_

PDB Entry: 1zn8 (more details), 1.76 Å

PDB Description: Human Adenine Phosphoribosyltransferase Complexed with AMP, in Space Group P1 at 1.76 A Resolution
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d1zn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zn8a_ c.61.1.1 (A:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

SCOPe Domain Coordinates for d1zn8a_:

Click to download the PDB-style file with coordinates for d1zn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1zn8a_: