Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Adenine PRTase [53288] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [102536] (4 PDB entries) |
Domain d1zn8a_: 1zn8 A: [125376] automated match to d1orea_ complexed with amp, cl |
PDB Entry: 1zn8 (more details), 1.76 Å
SCOPe Domain Sequences for d1zn8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zn8a_ c.61.1.1 (A:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
Timeline for d1zn8a_: