Lineage for d1zn7b1 (1zn7 B:3-180)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838986Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 838987Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 838988Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 838989Protein Adenine PRTase [53288] (5 species)
  7. 838997Species Human (Homo sapiens) [TaxId:9606] [102536] (4 PDB entries)
  8. 838999Domain d1zn7b1: 1zn7 B:3-180 [125375]
    automatically matched to d1orea_
    complexed with ade, mg, po4, prp, rp5

Details for d1zn7b1

PDB Entry: 1zn7 (more details), 1.83 Å

PDB Description: human adenine phosphoribosyltransferase complexed with prpp, ade and r5p
PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOP Domain Sequences for d1zn7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zn7b1 c.61.1.1 (B:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

SCOP Domain Coordinates for d1zn7b1:

Click to download the PDB-style file with coordinates for d1zn7b1.
(The format of our PDB-style files is described here.)

Timeline for d1zn7b1: