SCOPe 2.04: Domain d1zn2a2: 1zn2 A:3-130

Lineage for d1zn2a2 (1zn2 A:3-130)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulatory protein StyR, N-terminal domain [142027] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [142028] (2 PDB entries)
   Uniprot O30989 3-130

8. Domain d1zn2a2: 1zn2 A:3-130 [125372]
   Other proteins in same PDB: d1zn2a1
   automated match to d1yioa2
   complexed with mg

Details for d1zn2a2

PDB Entry: 1zn2, 2.91 Å

PDB Description: Low Resolution Structure of Response Regulator StyR

PDB Compounds: (A:) response regulatory protein

SCOPe Domain Sequences for d1zn2a2:

Sequence; same for both SEQRES and ATOM records:

>d1zn2a2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]}
akptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpgms
gielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqglql
naerrqar

Timeline for d1zn2a2:

• d1zn2a2 first appeared in SCOP 1.73
  
• d1zn2a2 appears in SCOPe 2.03
  
• d1zn2a2 appears in SCOPe 2.05
  
• d1zn2a2 appears in the current release, SCOPe 2.08