Lineage for d1zn0a1 (1zn0 A:1-185)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864674Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 864714Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 864715Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 864716Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 864719Species Escherichia coli [TaxId:562] [64292] (5 PDB entries)
  8. 864724Domain d1zn0a1: 1zn0 A:1-185 [125369]
    automatically matched to d1ek8a_

Details for d1zn0a1

PDB Entry: 1zn0 (more details), 15.5 Å

PDB Description: Coordinates of RRF and EF-G fitted into Cryo-EM map of the 50S subunit bound with both EF-G (GDPNP) and RRF
PDB Compounds: (A:) ribosome recycling factor

SCOP Domain Sequences for d1zn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zn0a1 d.67.3.1 (A:1-185) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]}
misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elmqf

SCOP Domain Coordinates for d1zn0a1:

Click to download the PDB-style file with coordinates for d1zn0a1.
(The format of our PDB-style files is described here.)

Timeline for d1zn0a1: