Lineage for d1zn0a1 (1zn0 A:1-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2957018Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 2957019Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 2957020Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 2957023Species Escherichia coli [TaxId:562] [64292] (5 PDB entries)
  8. 2957026Domain d1zn0a1: 1zn0 A:1-185 [125369]
    automatically matched to d1ek8a_
    protein/RNA complex

Details for d1zn0a1

PDB Entry: 1zn0 (more details), 15.5 Å

PDB Description: Coordinates of RRF and EF-G fitted into Cryo-EM map of the 50S subunit bound with both EF-G (GDPNP) and RRF
PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1zn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zn0a1 d.67.3.1 (A:1-185) Ribosome recycling factor, RRF {Escherichia coli [TaxId: 562]}
misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elmqf

SCOPe Domain Coordinates for d1zn0a1:

Click to download the PDB-style file with coordinates for d1zn0a1.
(The format of our PDB-style files is described here.)

Timeline for d1zn0a1: