Lineage for d1zmta_ (1zmt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842520Protein Halohydrin dehalogenase HheC [102153] (1 species)
    haloalcohol dehalogenase: evolved a new activity; lost the NAD-binding site
  7. 2842521Species Agrobacterium tumefaciens [TaxId:358] [102154] (5 PDB entries)
  8. 2842522Domain d1zmta_: 1zmt A: [125363]
    automated match to d1pwxa_
    complexed with rno

Details for d1zmta_

PDB Entry: 1zmt (more details), 1.7 Å

PDB Description: Structure of haloalcohol dehalogenase HheC of Agrobacterium radiobacter AD1 in complex with (R)-para-nitro styrene oxide, with a water molecule in the halide-binding site
PDB Compounds: (A:) Haloalcohol dehalogenase HheC

SCOPe Domain Sequences for d1zmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmta_ c.2.1.2 (A:) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkqkdeleafaetypqlkpmseqepae
lieavtsaygqvdvlvsndifapefqpidkyavedyrgavealqirpfalvnavasqmkk
rksghiifitsatpfgpwkelstytsaragactlanalskelgeynipvfaigpnylhse
dspyfyptepwktnpehvahvkkvtalqrlgtqkelgelvaflasgscdyltgqvfwlag
gfpmierwpgmp

SCOPe Domain Coordinates for d1zmta_:

Click to download the PDB-style file with coordinates for d1zmta_.
(The format of our PDB-style files is described here.)

Timeline for d1zmta_: