Lineage for d1zmga1 (1zmg A:1-370)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710663Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 710674Species Escherichia coli [TaxId:562] [53863] (45 PDB entries)
  8. 710706Domain d1zmga1: 1zmg A:1-370 [125362]
    automatically matched to 1ZIU A:1-370
    complexed with cu; mutant

Details for d1zmga1

PDB Entry: 1zmg (more details), 2.5 Å

PDB Description: crystal structure of copper-bound engineered maltose binding protein
PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOP Domain Sequences for d1zmga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmga1 c.94.1.1 (A:1-370) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwhhdhfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavmalsliynkd
llpnppktweeipaldkelkakgksalmfnlqepeftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafeyavrtavinaasgrqtvdea
lkdaqtritk

SCOP Domain Coordinates for d1zmga1:

Click to download the PDB-style file with coordinates for d1zmga1.
(The format of our PDB-style files is described here.)

Timeline for d1zmga1: