![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.10: SGNH hydrolase [52266] (10 families) ![]() |
![]() | Family c.23.10.7: Putative acetylxylan esterase-like [142058] (3 proteins) Pfam PF03629 (DUF303); contains a characteristic zinc(less) finger-like insertion after strand 1; lacks the conserved in other families Asn residue |
![]() | Protein automated matches [190859] (1 species) not a true protein |
![]() | Species Clostridium acetobutylicum [TaxId:272562] [188192] (1 PDB entry) |
![]() | Domain d1zmbe2: 1zmb E:1-282 [125359] Other proteins in same PDB: d1zmba1, d1zmba2, d1zmbb3, d1zmbc3, d1zmbd3, d1zmbe3, d1zmbf3 automated match to d1zmba1 |
PDB Entry: 1zmb (more details), 2.61 Å
SCOPe Domain Sequences for d1zmbe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zmbe2 c.23.10.7 (E:1-282) automated matches {Clostridium acetobutylicum [TaxId: 272562]} mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel lnlnyarthtkaekiyiksmdfalgkisydeftselmkinnd
Timeline for d1zmbe2: