Lineage for d1zmbe2 (1zmb E:1-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857465Family c.23.10.7: Putative acetylxylan esterase-like [142058] (3 proteins)
    Pfam PF03629 (DUF303); contains a characteristic zinc(less) finger-like insertion after strand 1; lacks the conserved in other families Asn residue
  6. 2857479Protein automated matches [190859] (1 species)
    not a true protein
  7. 2857480Species Clostridium acetobutylicum [TaxId:272562] [188192] (1 PDB entry)
  8. 2857484Domain d1zmbe2: 1zmb E:1-282 [125359]
    Other proteins in same PDB: d1zmba1, d1zmba2, d1zmbb3, d1zmbc3, d1zmbd3, d1zmbe3, d1zmbf3
    automated match to d1zmba1

Details for d1zmbe2

PDB Entry: 1zmb (more details), 2.61 Å

PDB Description: Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
PDB Compounds: (E:) Acetylxylan esterase related enzyme

SCOPe Domain Sequences for d1zmbe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmbe2 c.23.10.7 (E:1-282) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
lnlnyarthtkaekiyiksmdfalgkisydeftselmkinnd

SCOPe Domain Coordinates for d1zmbe2:

Click to download the PDB-style file with coordinates for d1zmbe2.
(The format of our PDB-style files is described here.)

Timeline for d1zmbe2: