Lineage for d1zmbc1 (1zmb C:1-282)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692305Superfamily c.23.10: SGNH hydrolase [52266] (7 families) (S)
  5. 692366Family c.23.10.7: Putative acetylxylan esterase-like [142058] (2 proteins)
    Pfam PF03629 (DUF303); contains a characteristic zinc(less) finger-like insertion after strand 1; lacks the conserved in other families Asn residue
  6. 692367Protein Acetylxylan esterase related enzyme [142061] (1 species)
  7. 692368Species Clostridium acetobutylicum [TaxId:1488] [142062] (1 PDB entry)
  8. 692371Domain d1zmbc1: 1zmb C:1-282 [125357]
    automatically matched to 1ZMB A:1-282

Details for d1zmbc1

PDB Entry: 1zmb (more details), 2.61 Å

PDB Description: Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6
PDB Compounds: (C:) Acetylxylan esterase related enzyme

SCOP Domain Sequences for d1zmbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmbc1 c.23.10.7 (C:1-282) Acetylxylan esterase related enzyme {Clostridium acetobutylicum [TaxId: 1488]}
mvksflmlgqsnmagrgfinevpmiyneriqmlrngrwqmmtepinydrpvsgislagsf
adawsqknqediiglipcaeggssidewaldgvlfrhalteakfamesseltgilwhqge
sdslngnykvyykkllliiealrkelnvpdipiiigglgdflgkerfgkgcteynfinke
lqkfafeqdncyfvtasgltcnpdgihidaisqrkfglryfeaffnrkhvleplinenel
lnlnyarthtkaekiyiksmdfalgkisydeftselmkinnd

SCOP Domain Coordinates for d1zmbc1:

Click to download the PDB-style file with coordinates for d1zmbc1.
(The format of our PDB-style files is described here.)

Timeline for d1zmbc1: