| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (15 proteins) |
| Protein Bacterocin transport accessory protein Bta [142355] (1 species) |
| Species Streptococcus pneumoniae [TaxId:1313] [142356] (1 PDB entry) |
| Domain d1zmaa1: 1zma A:1-115 [125354] complexed with fmt |
PDB Entry: 1zma (more details), 1.25 Å
SCOP Domain Sequences for d1zmaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]}
meqfldnikdlevttvvraqealdkketatffigrktcpycrkfagtlsgvvaetkahiy
finseepsqlndlqafrsrygiptvpgfvhitdgqinvrcdssmsaqeikdfagl
Timeline for d1zmaa1: