Lineage for d1zmaa1 (1zma A:1-115)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 698985Protein Bacterocin transport accessory protein Bta [142355] (1 species)
  7. 698986Species Streptococcus pneumoniae [TaxId:1313] [142356] (1 PDB entry)
  8. 698987Domain d1zmaa1: 1zma A:1-115 [125354]
    complexed with fmt

Details for d1zmaa1

PDB Entry: 1zma (more details), 1.25 Å

PDB Description: crystal structure of the bacterocin transport accessory protein from streptococcus pneumoniae
PDB Compounds: (A:) bacterocin transport accessory protein

SCOP Domain Sequences for d1zmaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]}
meqfldnikdlevttvvraqealdkketatffigrktcpycrkfagtlsgvvaetkahiy
finseepsqlndlqafrsrygiptvpgfvhitdgqinvrcdssmsaqeikdfagl

SCOP Domain Coordinates for d1zmaa1:

Click to download the PDB-style file with coordinates for d1zmaa1.
(The format of our PDB-style files is described here.)

Timeline for d1zmaa1: