Lineage for d1zm9c5 (1zm9 C:726-842)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724976Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 724977Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 724978Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 724979Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
  8. 724993Domain d1zm9c5: 1zm9 C:726-842 [125346]
    Other proteins in same PDB: d1zm9a1, d1zm9a2, d1zm9a3, d1zm9b1, d1zm9c1, d1zm9c2, d1zm9c3, d1zm9d1, d1zm9e1, d1zm9e2, d1zm9e3, d1zm9f1
    automatically matched to d1n0ua5
    complexed with dde, p34

Details for d1zm9c5

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (C:) Elongation factor 2

SCOP Domain Sequences for d1zm9c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm9c5 d.58.11.1 (C:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d1zm9c5:

Click to download the PDB-style file with coordinates for d1zm9c5.
(The format of our PDB-style files is described here.)

Timeline for d1zm9c5: