Lineage for d1zm9b_ (1zm9 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606370Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2606512Protein automated matches [190133] (7 species)
    not a true protein
  7. 2606585Species Pseudomonas aeruginosa [TaxId:287] [186856] (5 PDB entries)
  8. 2606589Domain d1zm9b_: 1zm9 B: [125341]
    Other proteins in same PDB: d1zm9a1, d1zm9a2, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9c1, d1zm9c2, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9e1, d1zm9e2, d1zm9e3, d1zm9e4, d1zm9e5
    automated match to d1aera_
    complexed with p34

Details for d1zm9b_

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (B:) exotoxin a

SCOPe Domain Sequences for d1zm9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm9b_ d.166.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d1zm9b_:

Click to download the PDB-style file with coordinates for d1zm9b_.
(The format of our PDB-style files is described here.)

Timeline for d1zm9b_: