Lineage for d1zm5a_ (1zm5 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204604Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2204605Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2204686Family d.89.1.5: Relaxase domain [103120] (3 proteins)
    circular permutation of the common fold
    automatically mapped to Pfam PF08751
  6. 2204698Protein automated matches [190037] (1 species)
    not a true protein
  7. 2204699Species Escherichia coli [TaxId:562] [186757] (2 PDB entries)
  8. 2204701Domain d1zm5a_: 1zm5 A: [125334]
    automated match to d1omha_
    protein/DNA complex; complexed with cu, so4

Details for d1zm5a_

PDB Entry: 1zm5 (more details), 2.5 Å

PDB Description: Conjugative Relaxase TRWC in complex with ORIT dna, cooper-bound structure
PDB Compounds: (A:) TrwC

SCOPe Domain Sequences for d1zm5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm5a_ d.89.1.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella
gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq
aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral
kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia
ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs

SCOPe Domain Coordinates for d1zm5a_:

Click to download the PDB-style file with coordinates for d1zm5a_.
(The format of our PDB-style files is described here.)

Timeline for d1zm5a_: