Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) |
Family d.89.1.5: Relaxase domain [103120] (3 proteins) circular permutation of the common fold automatically mapped to Pfam PF08751 |
Protein automated matches [190037] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [186757] (2 PDB entries) |
Domain d1zm5a_: 1zm5 A: [125334] automated match to d1omha_ protein/DNA complex; complexed with cu, so4 |
PDB Entry: 1zm5 (more details), 2.5 Å
SCOPe Domain Sequences for d1zm5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm5a_ d.89.1.5 (A:) automated matches {Escherichia coli [TaxId: 562]} mlshmvltrqdigraasyyedgaddyyakdgdasewqgkgaeelglsgevdskrfrella gnigeghrimrsatrqdskerigldltfsapksvslqalvagdaeiikahdravartleq aearaqarqkiqgktriettgnlvigkfrhetsrerdpqlhthavilnmtkrsdgqwral kndeivkatrylgavynaelahelqklgyqlrygkdgnfdlahidrqqiegfskrteqia ewyaargldpnsvsleqkqaakvlsrakktsvdrealraewqatakelgidfs
Timeline for d1zm5a_: