Lineage for d1zm4e5 (1zm4 E:726-842)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953476Protein Elongation factor 2 (eEF-2), C-terminal domain [419043] (2 species)
  7. 2953477Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419528] (13 PDB entries)
    Uniprot P32324
  8. 2953494Domain d1zm4e5: 1zm4 E:726-842 [125332]
    Other proteins in same PDB: d1zm4a1, d1zm4a2, d1zm4a3, d1zm4a4, d1zm4b_, d1zm4c1, d1zm4c2, d1zm4c3, d1zm4c4, d1zm4d_, d1zm4e1, d1zm4e2, d1zm4e3, d1zm4e4, d1zm4f_
    automated match to d1n0vc5
    complexed with tad

    has additional insertions and/or extensions that are not grouped together

Details for d1zm4e5

PDB Entry: 1zm4 (more details), 2.9 Å

PDB Description: Structure of the eEF2-ETA-bTAD complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm4e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm4e5 d.58.11.1 (E:726-842) Elongation factor 2 (eEF-2), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d1zm4e5:

Click to download the PDB-style file with coordinates for d1zm4e5.
(The format of our PDB-style files is described here.)

Timeline for d1zm4e5: