Lineage for d1zm4a5 (1zm4 A:726-842)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520427Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2520428Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2520429Protein Elongation factor 2 (eEF-2) [82677] (2 species)
  7. 2520430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
    Uniprot P32324
  8. 2520464Domain d1zm4a5: 1zm4 A:726-842 [125320]
    Other proteins in same PDB: d1zm4a1, d1zm4a2, d1zm4a3, d1zm4b_, d1zm4c1, d1zm4c2, d1zm4c3, d1zm4d_, d1zm4e1, d1zm4e2, d1zm4e3, d1zm4f_
    automated match to d1n0vc5
    complexed with tad

Details for d1zm4a5

PDB Entry: 1zm4 (more details), 2.9 Å

PDB Description: Structure of the eEF2-ETA-bTAD complex
PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d1zm4a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm4a5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d1zm4a5:

Click to download the PDB-style file with coordinates for d1zm4a5.
(The format of our PDB-style files is described here.)

Timeline for d1zm4a5: