Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) |
Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
Protein Elongation factor 2 (eEF-2) [82677] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) |
Domain d1zm4a4: 1zm4 A:482-560 [125319] Other proteins in same PDB: d1zm4a1, d1zm4a2, d1zm4a3, d1zm4b1, d1zm4c1, d1zm4c2, d1zm4c3, d1zm4d1, d1zm4e1, d1zm4e2, d1zm4e3, d1zm4f1 automatically matched to d1n0ua4 complexed with dde, tad |
PDB Entry: 1zm4 (more details), 2.9 Å
SCOP Domain Sequences for d1zm4a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm4a4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d1zm4a4:
View in 3D Domains from same chain: (mouse over for more information) d1zm4a1, d1zm4a2, d1zm4a3, d1zm4a5 |