![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (5 proteins) |
![]() | Protein Elongation factor 2 (eEF-2), domain IV [82575] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries) Uniprot P32324 |
![]() | Domain d1zm4a3: 1zm4 A:561-725 [125318] Other proteins in same PDB: d1zm4a1, d1zm4a2, d1zm4a4, d1zm4a5, d1zm4b_, d1zm4c1, d1zm4c2, d1zm4c4, d1zm4c5, d1zm4d_, d1zm4e1, d1zm4e2, d1zm4e4, d1zm4e5, d1zm4f_ automated match to d1n0vc3 complexed with tad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1zm4 (more details), 2.9 Å
SCOPe Domain Sequences for d1zm4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm4a3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d1zm4a3:
![]() Domains from same chain: (mouse over for more information) d1zm4a1, d1zm4a2, d1zm4a4, d1zm4a5 |